wasteclearancehertfordshire.co.uk

🖥 Status: up
🕒 Response Time: 0.182 sec
⬅️ Response Code: 200
wasteclearancehertfordshire.co.uk

Over the last 2 576 days beginning July 26, 2019, and ending today, 11 checks have been made on wasteclearancehertfordshire.co.uk's uptime. Wasteclearancehertfordshire.co.uk returned a code 200 during its most recent uptime on February 20, 2026, and was accessible 11 times during all tests. Based on the checks made as of August 14, 2026, no cases of inactivity were detected for wasteclearancehertfordshire.co.uk. No responses with an error status have been reported as of August 14, 2026, according to all received replies. Averaging 0.704 seconds, wasteclearancehertfordshire.co.uk had a response time of 0.182 seconds on February 20, 2026.

4.0
11
Last Updated: February 20, 2026

Wasteclearancehertfordshire overview

Domain
wasteclearancehertfordshire.co.uk
Title
Alternative Rubbish Clearance - House Clearance & Waste Removal
Description
Alternative Rubbish Clearance Offer A Complete House Clearance & Rubbish Removal Service, Based In Tring we offer all Aspects Of Clearance Work From Domestic To Commercial, Single Items To Multiple Loads.
Main Topic
Alternative Rubbish Clearance
Home
Call us today on Tel 01442 822560 / 07834 762827
Why choose Alternative Rubbish Clearance?
W Site Status Rank
730 185
Search Wikipedia
wasteclearancehertfordshire.co.uk
Alternatives
alternatives to wasteclearancehertfordshire.co.uk
Recently checked
washingmachinerepairservices.co.uk

mp3down-load.net

Last Updated: June 22, 2026
Status: down
Response Time: — sec
Response Code:

coldwellbanker.ca

Last Updated: December 21, 2025
Status: up
Response Time: 2.096 sec
Response Code: 200

multicopterwarehouse.com

Last Updated: April 25, 2026
Status: error
Response Time: 0.038 sec
Response Code: 403

bocanewsnow.com

Last Updated: June 6, 2026
Status: up
Response Time: 0.018 sec
Response Code: 200

wavesoftime.com

Last Updated: February 24, 2026
Status: up
Response Time: 0.142 sec
Response Code: 200

azswimmingholes.com

Last Updated: July 8, 2026
Status: up
Response Time: 0.300 sec
Response Code: 200

whitakerfuneralhome.com

Last Updated: January 19, 2025
Status: up
Response Time: 1.309 sec
Response Code: 200

Wasteclearancehertfordshire.co.uk
status check request map as of August 14, 2026

wasteclearancehertfordshire.co.uk request, February 20, 2026

Country report for wasteclearancehertfordshire.co.uk as of August 14, 2026

Mexico 100.00%
03:26
SiteTotal ChecksLast Modified
warwickovencleaners.co.ukwarwickovencleaners.co.uk1August 14, 2026
washingmachinerepairservices.co.ukwashingmachinerepairservices.co.uk4April 11, 2026
wasteclearancehertfordshire.co.ukwasteclearancehertfordshire.co.uk11July 26, 2019
waterlifeswimschool.co.ukwaterlifeswimschool.co.uk2June 24, 2026
design.waterloo.co.ukdesign.waterloo.co.uk3August 1, 2019

Azswimmingholes.com

Wasteclearancehertfordshire.co.uk

General SEO Report

Page TitlePage Title tips for wasteclearancehertfordshire.co.uk: Website title optimization focuses on maximizing both technical SEO signals like keyword inclusion and schema alignment alongside user experience factors such as readability and compelling brevity in search preview snippets.
Alternative Rubbish Clearance - House Clearance & Waste Removal

Length: 67 characters
Meta DescriptionMeta Description tips for wasteclearancehertfordshire.co.uk: Meta descriptions are crucial on-page SEO signals and should be written as standalone snippets attractive enough for users to want to click through understandibly; consider content schema by including significant key-value pairs naturally, ensure character count respect the 160 limit strictly (allows for clear sentence structure), and use language that reflects the page title concisely yet sensitively adds unique value.
Alternative Rubbish Clearance Offer A Complete House Clearance & Rubbish Removal Service, Based In Tring we offer all Aspects Of Clearance Work From Domestic To Commercial, Single Items To Multiple Loads.

Length: 208 characters
Meta KeywordsMeta Keywords tips for wasteclearancehertfordshire.co.uk: Strategic content repurposing across different medium maximizes reach stretches resources turning previous creates into evergreen assets still attracting visitors years later.
no meta keywords data for wasteclearancehertfordshire.co.uk
2026-08-14T18:29:50+00:00
Page ContentPage Content tips for wasteclearancehertfordshire.co.uk: Develop page content designed to convert visitors into customers or leads, incorporating clear value propositions and addressing potential objections effectively.
Web Page Content Length: 35871 characters
H1 HeadingH1 Heading tips for wasteclearancehertfordshire.co.uk: Search engines, particularly focusing on semantic understanding, appreciate consistent use of H1 heading tags organized within a clear content hierarchy, which signals topical authority and valuable page structure to crawlers.
Alternative Rubbish Clearance
Home
Call us today on Tel 01442 822560 / 07834 762827
Why choose Alternative Rubbish Clearance?


Count: 4 heading tag
H2 HeadingsH2 Headings tips for wasteclearancehertfordshire.co.uk: Contemplate the conversational flow of your content to ensure H2 headers reflect natural turn-taking points where you logically anticipate common follow-up questions from your readers.
Or email us at : admin@wasteclearancehertfordshire.co.uk
Easier and cheaper than skip hire
Alternative Rubbish Clearance specialise in a range of
waste disposal & collection services to domestic and
commercial customers including house clearance service,
rubbish clearance, garden clearance, shop clearance, waste
electrical and electronic equipment, office clearance and refurbishments.
We cover all house clearance and rubbish clearance in Hertfordshire, Buckinghamshire and Bedfordshire on a daily basis. Wherever you are we can respond on the same day, 7 days a week.
In most cases we can offer a SAME DAY SERVICE, from one item to a full clearance. No attendance fee. Call us now for details.
Alternative Rubbish Clearance has over 30 years experience in house and rubbish clearance offering a competitive and reliable service in Tring, Berkhamsted, Hemel Hempstead, St. Albans, Watford , Chesham , Aylesbury, covering all Hertfordshire, Bedfordshire, Buckinghamshire and all surrounding areas.


Count: 10 heading tag
H3 HeadingsH3 Headings tips for wasteclearancehertfordshire.co.uk: Use H3 headers sparingly to introduce truly significant sub-points or detailed examples rather than overusing them for basic content segmentation, preserving their impact.
Waste disposal and house clearance services

Count: 1 heading tag
H4 HeadingsH4 Headings tips for wasteclearancehertfordshire.co.uk: Fragmented content lacking clear headers from H2 through H4 risks negative impacts search visibility attempting to convey a hierarchical structure search engines prefer.
no h4 headings data for wasteclearancehertfordshire.co.uk
2026-08-14T18:29:50+00:00
H5-H6 HeadingsH5-H6 Headings tips for wasteclearancehertfordshire.co.uk: The semantic meaning of H5 headers placed strategically offers valuable context to crawlers, emphasizing authority section subsections beyond superficial text.
no h5-h6 headings data for wasteclearancehertfordshire.co.uk
2026-08-14T18:29:50+00:00
Image ALT AttributesImage ALT Attributes tips for wasteclearancehertfordshire.co.uk: Be specific and evocative with your image descriptions, perhaps mentioning who and what is present in a photo, the type of scene or object depicted, and its direct impact or relevance within the page context.
https://images.squarespace-cdn.com/content/v1/5ec28583c9bd3a7e6e52edc6/1589812284854-V3DBWNTMAPF8L9NFZWRX/551490.png
https://images.squarespace-cdn.com/content/v1/5ec28583c9bd3a7e6e52edc6/1590408511743-WOCU1H9945XV53ZYUREF/590524.jpg
https://images.squarespace-cdn.com/content/v1/5ec28583c9bd3a7e6e52edc6/1590855734856-6YH2JZFFHG3N2B61BA7C/OIP.jpg
https://images.squarespace-cdn.com/content/v1/5ec28583c9bd3a7e6e52edc6/1589811555938-QSY7W7YCKMVB9W2YFOZV/15078038_242x112.png
https://images.squarespace-cdn.com/content/v1/5ec28583c9bd3a7e6e52edc6/1589993653192-BJI423QLMZ0ZQWK32RLT/th.jpeg


Count: 5 images with ALT attributes
Robots.txtRobots.txt tips for wasteclearancehertfordshire.co.uk: Incorrectly blocking the entire website in `robots.txt` using a wildcard pattern, `Disallow: /`, prevents search engines from finding and crawling any content publicly available.
file robots.txt was found on the website
XML SitemapXML Sitemap tips for wasteclearancehertfordshire.co.uk: Generate an XML sitemap tailored for your specific content structure and re- submit it whenever you add new content, update existing pages, block crawling with a sitemap with specific <priority> tags that add value, or frequently change URLs.
https://www.wasteclearancehertfordshire.co.uk/sitemap.xml

available for crawling
Page SizePage Size tips for wasteclearancehertfordshire.co.uk: Test page weight variations against diverse browser engine implementations, checking for potentially more efficient resource handling increasing browser-level compression benefits potentially discovered for smaller docs.
page size: 35 kb
Response TimeResponse Time tips for wasteclearancehertfordshire.co.uk: Dynamically optimize website response time by strategically using server-side caching mechanisms for frequently accessed data, along with database query optimization and code minification.
response time: 0.704 sec
Minify CSSMinify CSS tips for wasteclearancehertfordshire.co.uk: Cut through the noise of website slowness by aggressively minifying CSS, stripping away the often-overlooked but essential spaces and comments, thus creating lean, fast-loading assets that directly improve Core Web Vitals, leading to solid SEO ground for sustainable growth online.
Minified:
https://static1.squarespace.com/static/sitecss/5ec28583c9bd3a7e6e52edc6/56/50521cf884aeb45fa5cfdb80/5ec28841f77a725452663f12/963/site.css
Unminified:
https://fonts.googleapis.com/css2?family=Source+Sans+Pro:ital,wght@0,300;0,400;0,700;1,300;1,700
https://definitions.sqspcdn.com/website-component-definition/static-assets/website.components.button/d000fa94-0cfb-49d1-817f-78690b61d5a7_153/website.components.button.styles.css


included in the page
Minify JavaScriptMinify JavaScript tips for wasteclearancehertfordshire.co.uk: Employ advanced minification passes that rename variables and functions to extremely short names impossible for humans to decipher without source maps, maximizing file size reduction.
Minified:
//use.typekit.net/ik/V4vqAUyvpAn8vltco8sYQxUO6xJcKD9DBTnVNir9xNqfeGjIfFHN4UJLFRbh52jhWDm8jDJtFQ6DjD8KZ2FyFh9hZQ9kZAsRFy7oMkG0jAFu-WsoShFGZAsude80ZkoRdhXCHKoyjamTiY8Djhy8ZYmC-Ao1Oco8if37OcBDOcu8OfG0-cB1iABkOANyScZTSh6ljDJDFPoDSWmyScmDSeBRZPoRdhXCHKoDSWmyScmDSeBRZWFR-emqiAUTdcS0jhNlOeBRiA8XpWFR-emqiAUTdcS0jhNlOeBRiA8XpWFR-emqiAUTdcS0dcmXOeBDOcu8OeTyZamySKuzjW4c-WFGOAwkwD90SaBujW48Sagyjh90jhNlOeUzjhBC-eNDifUDSWmyScmDSeBRZWFR-emqiAUTdcS0jhNlOYiySas8jhU8jW4ydcF8-emkieZzScsD-e8kZPoRdkou-kUaiaS0jAFu-WsoShFGZAsude80ZkoRdhXCiaiaOcBRiA8XpWFR-emqiAUTdcS0dcmXOYiaikoySkolZPUaiaS0-cB1iABkOANyScZTSh6ljDJDFPoDSWmyScmDSeBRZPoRdhXCiaiaO1FUiABkZWF3jAF8ShFGZAsude80ZkoRdhXCiaiaO1iySas8jhU8jW4ydcF8-emkieZzScsD-e8kZPoRdkou-kJsZe80OAFzdcs8d1F8ZfuaZAJ7fbR_mgMMeMb6MTMgNp_pKMj.js
//assets.squarespace.com/@sqs/polyfiller/1.6/legacy.js
//assets.squarespace.com/@sqs/polyfiller/1.6/modern.js
//assets.squarespace.com/universal/scripts-compressed/extract-css-runtime-9955ad5995a2e1ec-min.en-US.js
//assets.squarespace.com/universal/scripts-compressed/cldr-resource-pack-22ed584d99d9b83d-min.en-US.js
//assets.squarespace.com/universal/scripts-compressed/common-vendors-stable-fbd854d40b0804b7-min.en-US.js
//assets.squarespace.com/universal/scripts-compressed/common-vendors-521b3d1ea2c5615b-min.en-US.js
//assets.squarespace.com/universal/scripts-compressed/common-bff30ef0ecfbeb97-min.en-US.js
//assets.squarespace.com/universal/scripts-compressed/performance-cba60b5f3aa909d1-min.en-US.js
https://definitions.sqspcdn.com/website-component-definition/static-assets/website.components.button/d000fa94-0cfb-49d1-817f-78690b61d5a7_153/website.components.button.visitor.js
https://static1.squarespace.com/static/ta/5052176b84aeb45fa5cfcc83/963/scripts/site-bundle.js
Unminified:
//assets.squarespace.com/universal/scripts-compressed/extract-css-moment-js-vendor-6f2a1f6ec9a41489-min.en-US.js


detected during site scan
Structured DataStructured Data tips for wasteclearancehertfordshire.co.uk: The frayed coherency leash suggests preemptive cognitive pressure reduction timed to terawatt discharge events, requiring anolygonal bio-signature dampening through selective priming methodologies within circadian pacing cycles...
no structured data data for wasteclearancehertfordshire.co.uk
2026-08-14T18:29:50+00:00
CDN UsageCDN Usage tips for wasteclearancehertfordshire.co.uk: A modern CDN distributes copies of your website assets across multiple data centers globally, drastically cutting down the physical distance data must travel to reach a requesting user's browser.
content is delivered via CDN
SSL certificatesSSL certificates tips for wasteclearancehertfordshire.co.uk: Focusing on verified SSL encryption provides tangible benefits for marketing departments aiming to enhance customer data security perception, directly contributing to improved web conversion rates and click-through metrics.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:1 021
Minimum Daily Visits:1 193
Minimum Daily Page Views:2 054
Minimum Monthly Unique Visitors:30 630
Minimum Monthly Visits:35 790
Minimum Monthly Page Views:61 620
Minimum Yearly Unique Visitors:367 560
Minimum Yearly Visits:429 480
Minimum Yearly Page Views:739 440
Maximum Daily Unique Visitors:1 292
Maximum Daily Visits:1 378
Maximum Daily Page Views:2 325
Maximum Monthly Unique Visitors:38 760
Maximum Monthly Visits:41 340
Maximum Monthly Page Views:69 750
Maximum Yearly Unique Visitors:465 120
Maximum Yearly Visits:496 080
Maximum Yearly Page Views:837 000

Estimated Valuation

Daily Revenue:US$ 1 - 3
Monthly Revenue:US$ 30 - 90
Yearly Revenue:US$ 360 - 1 080

Estimated Worth

Minimum:US$ 540
Maximum:US$ 3 240

Similarly Ranked Sites

RankPoints
warringtonhearing.co.ukwarringtonhearing.co.uk1 319 9017 029 809
warwickcarpetcleaners.co.ukwarwickcarpetcleaners.co.uk1 319 9027 029 808
warwickcleaners.co.ukwarwickcleaners.co.uk1 319 9037 029 808
warwickovencleaners.co.ukwarwickovencleaners.co.uk1 319 9047 029 807
washingmachinerepairservices.co.ukwashingmachinerepairservices.co.uk1 319 9057 029 807
wasteclearancehertfordshire.co.ukwasteclearancehertfordshire.co.uk1 319 9067 029 806
waterlifeswimschool.co.ukwaterlifeswimschool.co.uk1 319 9077 029 805
design.waterloo.co.ukdesign.waterloo.co.uk1 319 9087 029 805
watfordtaxi.co.ukwatfordtaxi.co.uk1 319 9097 029 804
wavehill.co.ukwavehill.co.uk1 319 9107 029 804
waveney-clearances.co.ukwaveney-clearances.co.uk1 319 9117 029 803